Description

LL37 5mg Peptide for Sale – Direct from Shanghai Manufacturer

LL-37 stands as a unique and powerful molecule in the human immune system—the only cathelicidin-derived antimicrobial peptide expressed in humans. This 37-amino acid host defense peptide plays a critical role in innate immunity, directly killing pathogens while modulating immune responses and promoting wound healing. If you are searching for “LL37 peptide for sale” for your laboratory investigations in Australia, you need a manufacturing partner who understands the complexity of this host defense peptide and can deliver the purity your studies demand. That partner is Shanghai Apeptides Co., Ltd.

We are a legitimate, licensed manufacturer operating from our headquarters at No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai, China. Our facility is dedicated to the research, development, and production of high-purity peptide raw materials, catalog peptides, fluorescent dyes, and amino acids. When you purchase LL37 5mg peptide from shanghaiapeptides.com, you are buying directly from the source—not a middleman or reseller.

Understanding LL-37: The Human Cathelicidin

LL-37 (also known as hCAP18-derived antimicrobial peptide) is a 37-amino acid peptide that is cleaved from the C-terminal end of the human cathelicidin protein, hCAP18. It is the sole member of the cathelicidin family expressed in humans and plays a multifaceted role in immune defense and cellular regulation.

Key Characteristics

Parameter	Specification
Sequence	[LL-37, 37 aa]
Molecular Formula	C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight	Approximately 4,493.3 g/mol
CAS Number	154947-66-7
Form	Lyophilized powder
Purity	≥99% (verified by HPLC)
Storage	-20°C, protected from light and moisture

Structural Features

Feature	Description	Functional Significance
Amphipathic α-Helix	Forms helical structure in membrane-mimetic environments	Essential for membrane disruption
37 Amino Acids	LL-37 derived from N-terminal LL residues	Full-length bioactive peptide
Cationic Nature	Net positive charge (+6 at neutral pH)	Electrostatic attraction to bacterial membranes
C-Terminal Amidation	Not amidated (free C-terminus)	Distinct from many antimicrobial peptides

Why LL-37 Matters in Research

LL-37 has been extensively studied for its dual role as a direct antimicrobial agent and an immunomodulatory peptide. Unlike conventional antibiotics that simply kill bacteria, LL-37 also modulates host immune responses, making it a unique tool for investigating host-pathogen interactions.

Key Research Applications

Research Area	Key Findings	Research Context
Antimicrobial Activity	Kills bacteria, fungi, viruses, and parasites via membrane disruption	Infectious disease, drug resistance
Immunomodulation	Chemoattractant for immune cells; modulates cytokine release	Inflammation, autoimmune disease
Wound Healing	Promotes angiogenesis and re-epithelialization; reduces biofilm formation	Wound healing models, tissue repair
Biofilm Research	Inhibits biofilm formation and disrupts established biofilms	Chronic infections, medical device research
Cancer Biology	Induces apoptosis in certain cancer cell lines; modulates immune response	Oncology, tumor immunology
Inflammatory Diseases	Dysregulated in psoriasis, rosacea, and inflammatory bowel disease	Dermatology, gastroenterology
Host Defense Mechanisms	Functions as alarmin; activates immune cells	Innate immunity, immunology

The Manufacturer Advantage: Why Source LL-37 from Shanghai Apeptides

When you search for “LL37 peptide for sale” in Australia, you encounter many options. Here is why direct sourcing from our Shanghai facility is the superior choice.

Complete Transparency

• Physical Location: No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai, China
• Manufacturing Expertise: Decades of combined experience in peptide synthesis and biochemical production
• No Middlemen: Manufacturer-direct pricing without reseller markups

Technical Expertise

Our team understands the specific requirements for LL-37 research:

• Proper handling to prevent aggregation
• Appropriate reconstitution for antimicrobial assays
• Storage conditions to maintain activity
• Documentation requirements for research compliance

Quality You Can Trust

• Rigorous HPLC and MS testing
• Full Certificates of Analysis (COAs)
• Reliable batch-to-batch consistency

Seamless Supply to the Australian Market

Sourcing LL37 5mg peptide from China should be straightforward. We have optimized our logistics specifically for Australian researchers and wholesale partners.

• Fast Shipping: 5–7 business days to Australian addresses
• Cold-Chain Packaging: Temperature-controlled transit at -20°C
• Desiccant Protection: Double-sealed packaging to prevent moisture absorption
• Wholesale Programs: Dedicated support for Australian supply companies
• Customs Expertise: Smooth clearance with complete documentation
• Tracking Integration: Real-time shipment visibility from Shanghai to your laboratory

Frequently Asked Questions

What exactly is LL37 peptide for sale at Shanghai Apeptides?

LL-37 is a 37-amino acid antimicrobial peptide and the only cathelicidin-derived peptide expressed in humans. It exhibits broad-spectrum antimicrobial activity and immunomodulatory functions. It is supplied strictly for laboratory investigation and in vitro research only, not for human consumption.

What purity levels do you guarantee for LL-37?

We guarantee ≥99% purity, verified by HPLC testing with Certificates of Analysis available for every batch.

Is your LL-37 for human consumption?

Absolutely not. Our LL-37 is strictly for research and laboratory use only. It is not for human consumption, clinical application, or any use involving humans or animals.

Do you ship across Australia?

Yes. We ship to research institutions, laboratories, and wholesale partners throughout Australia.

Can you accommodate bulk orders for wholesale distribution?

Absolutely. We offer competitive wholesale pricing for qualified Australian partners. Contact our team through shanghaiapeptides.com with your volume requirements.

Quality Control: The Shanghai Apeptides Standard

Your research deserves nothing less than the highest purity materials. Our quality control protocols exceed industry standards.

Analytical Methods

• HPLC Analysis: Every batch tested for purity (typically 99%+)
• Mass Spectrometry: Molecular weight confirmation (4,493.3 Da expected)
• Amino Acid Analysis: Sequence verification
• Peptide Content Determination
• Counterion Analysis
• Endotoxin Testing available for cell culture applications
• Stability Studies

Batch Documentation

Each shipment includes:

• Certificate of Analysis
• HPLC chromatogram upon request
• Mass spectrometry data
• Batch number for traceability
• Expiration date and storage recommendations
• Reconstitution guidelines

Beyond LL-37: A Complete Research Partner

Shanghai Apeptides Co., Ltd. is more than just a supplier of LL37 peptide for sale. We are a full-service biochemical manufacturer committed to advancing peptide research worldwide.

Our Capabilities

• Custom peptide synthesis
• Catalog peptides for immediate shipment
• Antimicrobial peptide libraries
• Fluorescent dyes
• High-purity amino acids

Quality Certifications & Compliance

• Licensed peptide manufacturer in Pudong District, Shanghai
• Strict quality control systems
• Transparent documentation and traceability
• Experienced technical support
• Research-use-only compliance

The Science Behind LL-37

LL-37 was first identified in 1995 as the C-terminal peptide of the human cathelicidin protein hCAP18. The name “LL-37” derives from its N-terminal leucine residues and its length of 37 amino acids.

The peptide adopts an amphipathic α-helical structure in membrane-mimetic environments, enabling membrane disruption and antimicrobial activity. Beyond pathogen defense, LL-37 functions as an “alarmin” that alerts the immune system to infection and tissue injury.

LL-37 levels are dysregulated in several human diseases including psoriasis, rosacea, inflammatory bowel disease, and atopic dermatitis, making it a valuable research tool in immunology, dermatology, and infectious disease studies.

The search for premium “LL37 peptide for sale” in Australia ends at Shanghai Apeptides Co., Ltd. As a dedicated manufacturer of peptides and biochemicals, we combine scientific expertise with manufacturing integrity to deliver the purest research materials available. Whether you need LL-37 for antimicrobial research, immunology studies, wound healing investigations, or specialized host defense research, we are your trusted manufacturing partner.