Description

Here’s a cleaned and localized replacement version you can use across your product pages. I updated:

• “Chinese Peptide Company” → “Shanghai Apeptides”
• “USA / US market” → “Australia / Australian market”
• Improved SEO readability
• Reduced keyword stuffing from repeated “LL37 peptide for sale”
• Made the wording more professional and natural for Australian SEO

LL37 5mg Peptide for Sale in Australia – Direct from Shanghai Apeptides

LL-37 is a unique and powerful antimicrobial peptide naturally expressed in the human immune system. As the only cathelicidin-derived peptide found in humans, LL-37 plays a vital role in innate immunity, pathogen defense, immune modulation, and wound-healing research.

If you are searching for premium-quality LL37 peptide for sale in Australia, Shanghai Apeptides provides laboratory-grade LL-37 manufactured to the highest purity standards for research applications.

Shanghai Apeptides is a licensed peptide manufacturer headquartered at No. B Room 326, Jinhai Road 2588, Pudong District, Shanghai, China. Our facility specializes in the development and production of high-purity peptides, amino acids, fluorescent dyes, and research biochemicals.

When you purchase LL37 5mg from Shanghai Apeptides, you are sourcing directly from the manufacturer — not from a reseller or middleman.

Understanding LL-37

LL-37 is a 37-amino acid antimicrobial peptide derived from the human cathelicidin protein hCAP18. It is widely studied for its broad-spectrum antimicrobial activity and immunomodulatory properties.

Product Specifications

Parameter	Specification
Sequence	[LL-37, 37 aa]
Molecular Formula	C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight	Approximately 4,493.3 g/mol
CAS Number	154947-66-7
Form	Lyophilized Powder
Purity	≥99% (HPLC Verified)
Storage	Store at -20°C away from light and moisture

Key Research Applications

• Antimicrobial activity studies
• Biofilm inhibition research
• Immunology and inflammation studies
• Wound-healing investigations
• Host defense mechanism research
• Cancer biology and apoptosis studies

Why Researchers Choose Shanghai Apeptides

Manufacturer Direct Pricing

Purchase directly from our Shanghai manufacturing facility without reseller markups.

High-Purity Standards

Every LL-37 batch undergoes strict quality testing including:

• HPLC purity analysis
• Mass spectrometry confirmation
• Amino acid sequence verification
• Endotoxin testing
• Batch-specific Certificates of Analysis (COAs)

Reliable Shipping to Australia

We provide secure and temperature-controlled shipping to laboratories and research facilities across Australia.

• Fast international delivery
• Cold-chain packaging
• Moisture-protected sealed vials
• Full tracking visibility
• Wholesale supply options available

Quality Control Standards

Shanghai Apeptides follows rigorous peptide quality standards to ensure consistency and research reliability.

Analytical Testing Includes:

• HPLC purity testing (99%+)
• Mass spectrometry verification
• Amino acid analysis
• Peptide content determination
• Stability testing
• Counterion analysis

Frequently Asked Questions

Is LL-37 for human consumption?

No. LL-37 is strictly supplied for laboratory research and scientific investigation only. It is not intended for human or veterinary use.

What purity do you guarantee?

We provide ≥99% purity verified through HPLC analysis with batch-specific COAs.

How should LL-37 be stored?

Store lyophilized LL-37 at -20°C protected from moisture and light. Avoid repeated freeze-thaw cycles.

Do you ship throughout Australia?

Yes. We supply research peptides to laboratories and wholesale partners across Australia.

Your Trusted Research Peptide Manufacturer

Shanghai Apeptides is committed to delivering premium research peptides with transparent manufacturing, verified quality control, and dependable international supply.

Whether your research focuses on antimicrobial peptides, wound healing, immunology, or host defense mechanisms, our LL37 5mg peptide offers the purity and consistency required for advanced scientific investigations.

FOR RESEARCH USE ONLY. NOT FOR HUMAN CONSUMPTION.

Mazdutide 5mg Peptide for Sale in Australia – Direct from Shanghai Apeptides

Mazdutide is an advanced dual agonist peptide widely studied in metabolic research for its combined GLP-1 receptor and glucagon receptor activity. This next-generation peptide is increasingly investigated for its role in energy balance, glucose metabolism, weight regulation, and lipid metabolism.

If you are looking for premium Mazdutide peptide for sale in Australia, Shanghai Apeptides provides high-purity laboratory-grade Mazdutide manufactured to strict research standards.

Shanghai Apeptides is a licensed peptide manufacturer based in Pudong District, Shanghai, China, specializing in high-purity peptides, amino acids, fluorescent dyes, and custom synthesis solutions.

Understanding Mazdutide

Mazdutide (IBI362) is a synthetic dual GLP-1 and glucagon receptor agonist designed for metabolic and obesity-related research applications.

Product Specifications

Parameter	Specification
CAS Number	2259884-03-8
Form	Lyophilized Powder
Purity	≥99% (HPLC Verified)
Storage	-20°C protected from moisture and light
Molecular Weight	Approximately 4,500–4,600 g/mol

Research Applications

Researchers commonly investigate Mazdutide in:

• Obesity and weight-management studies
• Glucose metabolism research
• Insulin sensitivity investigations
• Energy expenditure studies
• NAFLD and fatty liver research
• Metabolic syndrome models

Why Choose Shanghai Apeptides

Direct Manufacturer Supply

Source directly from our Shanghai production facility with no reseller markups.

Research-Grade Purity

Every Mazdutide batch includes:

• HPLC purity verification
• Mass spectrometry confirmation
• Sequence analysis
• Stability testing
• Batch-specific COAs

Shipping Across Australia

We provide secure peptide delivery throughout Australia with:

• Temperature-controlled shipping
• Cold-chain packaging
• Moisture-resistant sealed containers
• Fast delivery times
• Wholesale supply support

Frequently Asked Questions

Is Mazdutide for human use?

No. Mazdutide is strictly intended for laboratory research and scientific investigation only.

What purity level do you provide?

Shanghai Apeptides guarantees ≥99% purity verified by HPLC testing.

How should Mazdutide be stored?

Store at -20°C protected from moisture and direct light exposure.

Do you provide wholesale supply?

Yes. Wholesale peptide supply programs are available for qualified research partners and distributors in Australia.

Premium Research Peptides from Shanghai Apeptides

Shanghai Apeptides delivers high-quality research peptides trusted by laboratories worldwide. Our commitment to quality control, manufacturing transparency, and reliable international shipping makes us a dependable supplier for advanced peptide research.